Η παρουσίαση φορτώνεται. Παρακαλείστε να περιμένετε

Η παρουσίαση φορτώνεται. Παρακαλείστε να περιμένετε

ΚΑΡΚΙΝΙΚΑ ΑΝΤΙΓΟΝΑ: ΧΑΡΑΚΤΗΡΙΣΜΟΣ ΚΑΙ ΤΑΥΤΟΠΟΙΗΣΗ ΤΟΥΣ Ράνια Τσιτσιλώνη.

Παρόμοιες παρουσιάσεις


Παρουσίαση με θέμα: "ΚΑΡΚΙΝΙΚΑ ΑΝΤΙΓΟΝΑ: ΧΑΡΑΚΤΗΡΙΣΜΟΣ ΚΑΙ ΤΑΥΤΟΠΟΙΗΣΗ ΤΟΥΣ Ράνια Τσιτσιλώνη."— Μεταγράφημα παρουσίασης:

1 ΚΑΡΚΙΝΙΚΑ ΑΝΤΙΓΟΝΑ: ΧΑΡΑΚΤΗΡΙΣΜΟΣ ΚΑΙ ΤΑΥΤΟΠΟΙΗΣΗ ΤΟΥΣ Ράνια Τσιτσιλώνη

2 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance

3 Immune Response to Malignant Tumors? Coley, 1893 BCG for bladder cancer? William Coley Coley’s toxin Bacterial preparation/Vaccine (Streptococcus + Staphylococcus) sarcomas 10% cure rate

4 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

5 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

6 KILLED TUMOR CELLS VIABLE TUMOR CELLS Immunological Memory for Tumor Cells Mitchison, 1967

7 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

8 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

9 Lymphocytes are “Trained” to Kill Tumor Cells tumor cells from melanoma patient lymphocytes from the same melanoma patient MLTC for one week recovered lymphocytes can kill melanoma cells recovered lymphocytes can proliferate Parmiani et al, 1971

10 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

11 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

12 Malignant Cells are Genetically Unstable up to 11,000 genomic alterations! Fenton & Longo, 1995

13 Το μοντέλο των διαδοχικών γενετικών “χτυπημάτων” στον καρκίνο του εντέρου MCCMSH2MLH1PMS1/2GTBPMCCMSH2MLH1PMS1/2GTBP Fearon, 1992

14 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

15 Κλωνοποίηση του 1 ου καρκινικού αντιγόνου Van den Eynde et al, 1991 CTL 2 CTL 1 Τu 1 Τu 3 Τu 2 CTL 3 1. Δημιουργία CTL CTL 1 + CTL 2 + CTL 3 + CTL 4 + λύση λύση λύση μη λύση CTL ευαίσθητο CTL ανθεκτικό 2. Screening 3. Διαμόλυνση ευκαρυωτικών κυττάρων ή βακτηρίων με καρκινικές cDNA βιβλιοθήκες 4. Δοκιμή λύσης από τα CTL 5. Κλωνοποίηση Ag με άμεσο πακετάρισμα σε λ-φάγους 1 ο ανθρώπινο καρκινικό Αg = MAGE-1 (μελάνωμα)

16 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

17 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

18 DCs Elicit Effective Antitumor Responses deLuca & Gommerman, 2012

19 Terne et al, 2009 Τα “αδειοδοτημένα” DCs στον όγκο Μη “αδειοδοτημένο”

20 Terne et al, 2009 Τα “αδειοδοτημένα” DCs στον όγκο Μη “αδειοδοτημένο” “Aδειοδοτημένο”

21 Τα “αδειοδοτημένα” DCs στον όγκο DCs GFP B16 RFP Hoffman, 2004

22 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

23 The Design of a Clinical Trial Schedule? ….Years?

24 Lee et al, 2005 Η απόδειξη στα ποντίκια… Μάρτυρας Ημέρα 15 Ημέρα 42

25 …αλλά και στον άνθρωπο Schott et al, 2005 Μεταστατικό μυελοειδές καρκίνωμα του θυρεοειδούς ήπαρ πνεύμονες Εβδομάδα 0 Μετά από 13 εβδομάδες

26 FDA fast-track grant! Νοέμβριος 2005: έγκριση του 1 ου κυτταρικού εμβολίου λευκαφαίρεση απομόνωση APC Ag PAP GM-CSF φόρτωμα APC με Ag Ασθενής Small et al, 2005 Provenge Provenge-ενεργοποιημένο Τ κύτταρο ανενεργό Τ κύτταρο τα ενεργοποιημένα Τ κύτταρα πολλαπλασιάζονται…. …και σκοτώνουν τα προστατικά καρκινικά κύτταρα

27 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

28 The Tumor Microenvironment Kerkar & Restifo, 2012 NK cells, NKT cells, Dendritic cells, Macrophages, Eosinophils, Mast cells γδT cells….

29 LANDMARKS IN TUMOR IMMUNOLOGY 1950s: Burnet: malignant cells are “self” 1971: human lymphocytes can kill autologous melanoma cells in vitro 1991: cloning of the first tumor antigen …: therapeutic & prophylactic vaccines in the market 1890: the immune system may responds to cancer: first indications 1967: immunological “memory” for cancer cells immunoprotection/immune surveillance in mice 1970: athymic nude mice have normal incidence of tumors 1976: Hewitt: spontaneously arising tumors are NOT recognized by the immune system 1985: tumor cells generate immunogenic variants that elicit T cell responses (TAAs) 1995: “licensed” DCs elicit tumor-specific T cell immunity 1992: Schwartz: tumors lack costims  peripheral T cell tolerance …: tumor vaccines; clinical trials …: role of innate immune system in tumor immunosurveillance BUT

30 Available Cancer Vaccines Prophylactic Therapeutic  Provenge (prostate cancer)  Oncophage (kidney cancer, metastatic melanoma, glioma) melanoma, glioma)  OncoVEX (melanoma, head & neck cancer)  mAbs (Herceptin, Rituxan, Mylotarg, etc)  CimaVax-EGF (lung); Neuvenge (breast, bladder, colon, ovarian); NeuVax (HER/neu tumors); BiovaxID ovarian); NeuVax (HER/neu tumors); BiovaxID (follicular lymphoma); ADXS31 (renal, colon); (follicular lymphoma); ADXS31 (renal, colon); SCIB1(melanoma) SCIB1(melanoma)  HPV vaccine (h. cervical cancer)  HBV vaccine (liver cancer)  mucin I (colon cancer) ?  breast cancer? pancreatic cancer? Finn OJ, 2003

31 SHOULD: express MHC class I & class II molecules  express MHC class I & class II molecules  express increased levels of TSA or TAA  express costimulatory signals  express adhesion molecules  secrete cytokines that differentiate and activate effector cells A tumor cell to be immunogenic

32 Express MHC class I / II molecules MHC class I/II TCRTCR

33 Express increased levels of TSA/TAA TCRTCR

34 Express costimulatory signals MHC class I/II TCRTCR costimulators (CD80, CD86) costimulators 1 2 CD8/CD4 p56 lck CD28CD28

35 Express adhesion molecules TCRTCR 1 2 p56 lck LFA-1LFA-1 CD2CD2 ICAM-1ICAM-1 LFA-3LFA-3 CD28CD28 MHC class I/II costimulators (CD80, CD86) costimulators CD8/CD4

36 Produce & secrete “good” cytokines TCRTCR 1 2 p56 lck IL-1IL-6 TNF-α IL-12 IL-15 LFA-1LFA-1 CD2CD2 ICAM-1ICAM-1 LFA-3LFA-3 CD28CD28 IFN-γ IL-4 MHC class I/II costimulators (CD80, CD86) costimulators CD8/CD4 3

37 Τα χαρακτηριστικά των καρκινικών κυττάρων Αντιστέκονται στον κυτταρικό θάνατο Προωθούν την αγγειογένεση Πολλαπλασιάζονται συνέχεια Είναι αθάνατα Δεν υπακούν στους αναστολείς της ανάπτυξης Ενεργοποιούν τη διήθηση και μετάσταση + αποφεύγουν την καταστροφή από το ανοσοποιητικό σύστημα Hanahan & Weinberg, 2011

38 Γιατί να ενεργοποιήσουμε το ανοσοποιητικό σύστημα ? γιατί τα κύτταρά του:  γιατί τα κύτταρά του: “ ταξιδεύουν” σε όλο το σώμα “ ταξιδεύουν” σε όλο το σώμα ενεργοποιούνται από τον καρκίνο ενεργοποιούνται από τον καρκίνο δεν είναι τοξικά δεν είναι τοξικά παρέχουν “συνεχή χημειοθεραπεία” παρέχουν “συνεχή χημειοθεραπεία” έχουν μνήμη έχουν μνήμη μπορούν να προστατεύσουν από υποτροπές μπορούν να προστατεύσουν από υποτροπές

39 Tα Τ κύτταρα «βλέπουν» το εσωτερικό του καρκινικού κυττάρου Berzofsky et al, 2004

40 Human Tumors are Immunogenic : because:  tumor cellsexpress defined antigens (>500 known)  tumor cells express defined antigens (>500 known)  solid tumors have infiltrating lymphocytes  tumor-specific T cells and Abs in the periphery of cancer patients  some tumors regress spontaneously :  BUT: most tumor antigens are “self” proteins most tumor antigens are “self” proteins tumors induce tolerance tumors induce tolerance tumors induce immune suppression (Tregs) tumors induce immune suppression (Tregs)

41 Η φύση των καρκινικών αντιγόνων a.Tumor specific antigens (TSA), present only on tumor cells encoded by genes specifically expressed by tumors (MAGE) encoded by variant forms of normal genes altered by mutations (β-catenin) b. Tumor associated antigens (TAA), present on tumor cells and some normal cells normally expressed at certain differentiation stages or lineages (tyrosinase, Melan-A/MART-1) mutated proteins (k-ras, p53) overexpressed proteins (HER-2/neu)

42 Μηχανισμοί δημιουργίας καρκινικών αντιγόνων (or specific gene expression) (or expression of mutated protein)

43 Καρκινικά Ags (πεπτίδια ή πρωτεΐνες)  Ογκοεμβρυϊκές πρωτεΐνες (CEA, α-FP)  Ογκοπρωτεΐνες (p53, HER2, ras)  Ογκοϊικές πρωτεΐνες (HBV, EBV, HPV)  Γλυκοσυλιωμένες πρωτεΐνες (muc1)  Μεταλλαγμένες πρωτεΐνες (BRCA1/2)  Περιορισμένες σε ιστό (PSA, Melan-A/MART-1)  Εκχυλίσματα καρκινικών κυττάρων  Τμήματα DNA με επιθυμητό γονίδιο

44 Μέθοδοι ταυτοποίησης  Γενετική προσέγγιση  Βιοχημική προσέγγιση  Αντίστροφη ανοσολογία (reverse immunology)  Ορολογική προσέγγιση (SEREX)  Χρησιμοποίηση διαγονιδιακών ποντικών

45 Γενετική προσέγγιση (Ι)  Δημιουργία CTL σειρών έναντι αυτόλογων καρκινικών κυττάρων  Οι CTL σειρές εμπεριέχουν πολλούς CTL κλώνους που αναγνωρίζουν ΤΑΑ πάνω στους κλώνους των καρκινικών κυττάρων CTL 2 CTL 3 CTL 1 Τu 1 Τu 3 Τu 2

46  Κλωνοποίηση καρκινικών και έλεγχος λύσης τους από τις αυτόλογες CTL σειρές.  Οι καρκινικοί κλώνοι που είναι αρνητικοί για το ΤΑΑ δεν αναγνωρίζονται και επιβιώνουν. CTL 1 + Λύση CTL ευαίσθητος CTL 2 + Λύση CTL ευαίσθητος CTL 3 + Λύση CTL ευαίσθητος CTL 4 + Όχι λύση CTL ανθεκτικός Γενετική προσέγγιση (ΙΙ)

47 Γενετική προσέγγιση (ΙΙΙ)  Δημιουργία γενομικών ή cDNA βιβλιοθηκών από τους CTL ευαίσθητους καρκινικούς κλώνους  Διαμόλυνση CTL ανθεκτικών καρκινικών κυττάρων (αυτόλογων ή που να εκφράζουν το κατάλληλο ΜΗC αλληλόμορφο) με το cDNA  Χαρακτηρισμός των διαμολυνθέντων κυττάρων που εκφράζουν το ΤΑΑ βασιζόμενοι στην ικανότητα τους να λύονται από το ανάλογο ογκοειδικό CTL  Απομόνωση του γονιδίου που κωδικοποιεί για το ΤΑΑ με άμεσο πακετάρισμα σε λ-φάγους

48 Βιοχημική προσέγγιση (Ι)  Δημιουργία CTL σειρών έναντι αυτόλογων καρκινικών κυττάρων CTL Τumor cell  Εκχύλιση των πεπτιδίων που βρίσκονται στις σχισμοειδείς θήκες των MHC μορίων. MHC molecule Antigenic peptide

49 Βιοχημική προσέγγιση (ΙΙ)  Διαχωρισμός των πεπτιδίων με HPLC και συλλογή των επιμέρους κλασμάτων.  Φόρτωμα του κάθε πεπτιδικού κλάσματος σε κύτταρα-στόχους που φέρουν πανομοιότυπα MHC αλληλόμορφα (πχ Τ2) και έλεγχος λύσης τους από τα ογκοειδικά CTL. CTL

50 Βιοχημική προσέγγιση (ΙΙΙ)  Ταυτοποίηση του πεπτιδίου με δεύτερο διαχωρισμό σε αναλυτικότερο HPLC, αποικοδόμηση κατά Edman και φασματοσκοπία μάζας (tandem mass spectrometry). TAA peptide 1 TAA peptide 2 TAA peptide 3 TAA peptide 4

51 Αντίστροφη ανοσολογία (Ι)  Σύνθεση πεπτιδίων από την αλληλουχία μιας ογκοειδικής πρωτεΐνης (πχ. HER2/neu) βασιζόμενοι στην παρουσία συγκεκριμένων αμινοξικών καταλοίπων (anchor motifs) για ένα ορισμένο αλληλόμορφο (πχ HLA-A2). Βάσεις για πρόβλεψη πεπτιδίων μέσω αλγορίθμων:  

52 Position Position FWILVMFWILVM PWILVADEPWILVADE NSTQHRNSTQHR HLA-A2 HLA-DR4 anchors or auxiliary anchors L V V M L preferred residues E K other residues I A G I I A E L Y P K L Y S F F D Y T H K P T N M M G Y S F V R V H anchors or auxiliary anchors DEHKNQRSTYACILMVDEHKNQRSTYACILMV DEHKNQRSTYACILMVDEHKNQRSTYACILMV

53 Αντίστροφη ανοσολογία (ΙΙ)  Έλεγχος συγγένειας πρόσδεσης σε MHC (συγκέντρωση πεπτιδίου που αναστέλλει το 50 % της πρόσδεσης γνωστού πεπτιδίου MHC-προσδέτη) ΜΗC νέο πεπτίδιο MHC-προσδέτηςβ2-μικροσφ 100 % πρόσδεση % πρόσδεση  Ικανότητα πεπτιδίου να επάγει CTL (δημιουργία CTL ικανών να λύουν κύτταρα-στόχους [Τ2] φορτωμένα με το πεπτίδιο) CTL + Λύση T2

54 Αντίστροφη ανοσολογία (ΙΙΙ)  Έκφραση του πεπτιδίου και σε καρκινικά κύτταρα τα οποία να λύονται από τα CTL εφόσον εκφράζουν την πατρική ογκοπρωτεΐνη (ο επίτοπος να είναι και naturally processed) CTL + Λύση T2 CTL + Λύση Tu επεξεργασία του αντιγόνου

55 Ορολογική προσέγγιση (Ι) SEREX: serological analysis of the autologous tumor antigens by recombinant cDNA expression  Δημιουργία cDNA βιβλιοθήκης από φρέσκα καρκινικά δείγματα (πχ. χειρουργικά αφαιρεθέντες όγκοι ή καρκινικά κύτταρα από ασκιτικά και πλευριτικά υγρά)  Η βιβλιοθήκη κλωνοποιείται σε λ-φάγο  Οι ανασυνδυασμένοι φάγοι μεταφέρουν το DNA σε βακτήρια E. coli (λυτική μόλυνση)  Μεταφορά ανασυνδυασμένων πρωτεϊνών σε μεμβράνες νιτροκυτταρίνης  Ανίχνευση αντιδραστικότητάς τους με IgG αντισώματα που υπάρχουν στον ορό του ασθενούς (χρήση αραιωμένου ορού του ασθενούς)  Προσδιορισμός της αλληλουχίας νουκλεοτιδίων από το εισαχθέν cDNA.

56 Ορολογική προσέγγιση (II)

57 Ορολογική προσέγγιση (IIΙa) Πλεονεκτήματα της μεθόδου SEREX  Χρησιμοποίηση κυττάρων από τον όγκο: δεν χρειάζεται καλλιέργεια καρκινικών κυττάρων in vitro, μείωση artifacts λόγω μακρόχρονης καλλιέργειας (πχ. έκφραση νέων αντιγόνων από τα καρκινικά)  Εντοπισμός αντιγόνων που προκαλούν ισχυρή ανοσοαπόκριση στον καρκινοπαθή (ο ορός του ασθενή αραιώνεται 1:100-1:1000 και άρα οδηγεί στον εντοπισμό IgG ανοσοσφαιρινών που βρίσκονται σε υψηλό τίτλο στον ορό, άρα επάγεται υψηλού βαθμού ενεργοποίηση των Τh κυττάρων)  Με τη χρησιμοποίηση cDNA βιβλιοθηκών η ανάλυση δεν περιορίζεται σε επιφανειακά αντιγόνα, αλλά καλύπτει το σύνολο των πρωτεϊνών που εκφράζονται από τα γονίδια του όγκου  Επιτρέπει τον απευθείας μοριακό προσδιορισμό των αντιγόνων αφού η αλληλουχία του cDNA των αντιγόνων του όγκου μπορεί να προσδιοριστεί άμεσα  Η έκφραση του αντιγόνου σε φυσιολογικό ιστό μπορεί να προσδιοριστεί με ανάλυση της έκφρασης του mRNA με Nothern Blot και Reverse Transcription-PCR, χωρίς να χρειάζεται η καλλιέργεια κυττάρων που μπορεί να οδηγήσει σε artifacts

58 Ορολογική προσέγγιση (IΙIb)  Ψευδώς θετικά αποτελέσματα: προέρχονται από την έκφραση γονιδίων ανοσοσφαιρινών στα βακτήρια λόγω της ύπαρξης λεμφοκυττάρων ανάμεσα στα κύτταρα του όγκου κατά την κατασκευή της cDNA βιβλιοθήκης.  Δεν μπορεί να ανιχνευτεί όλο το φάσμα των καρκινικών αντιγόνων (πχ. γλυκοσυλιωμένα αντιγόνα ή αντιγόνα που υπόκεινται σε μετατροπές κατά την έκφρασή τους σε βακτήρια)  Χάνονται αντιγόνα που δεν έχουν προλάβει να προκαλέσουν ανοσολογική απόκριση από τον οργανισμό κατά τη στιγμή της χειρουργικής αφαίρεσης του όγκου Προβλήματα της μεθόδου SEREX

59 Χρήση διαγονιδιακών ζώων (Ι)  Σύνθεση πεπτιδίων με επικαλυπτόμενες αλληλουχίες από μια ανθρώπινη ογκοειδική ή ογκοσχετιζόμενη πρωτεΐνη πατρική πρωτεΐνη

60 Χρήση διαγονιδιακών ζώων (ΙΙ)  Ανοσοποίηση διαγονιδιακών ποντικών που εκφράζουν συγκεκριμένο HLA αλληλόμορφο με την ανασυνδυασμένη πατρική ογκοπρωτεΐνη HLA-A2HLA-B27 ογκοπρωτεΐνηογκοπρωτεΐνη Τ λεμφοκύτταρα που αναγνωρίζουν HLA-A2-περιοριζόμενα πεπτίδια από την ογκοπρωτεΐνη Τ λεμφοκύτταρα που αναγνωρίζουν HLA-B27-περιοριζόμενα πεπτίδια από την ογκοπρωτεΐνη

61 Χρήση διαγονιδιακών ζώων (ΙΙΙ)  Δοκιμασία παραγωγής IFN-γ από Τ λεμφοκυττάρων των ποντικών όταν ενεργοποιηθούν με τα συνθετικά πεπτίδια (ELISA ή ELISPOT) ELISPOT +/ve -/ve +/ve ELISA -/ve+/ve

62 naked CTL +/- helper epitopes naked CTL +/- helper epitopes combined with cytokines (IL-2, IL-12) combined with cytokines (IL-2, IL-12) with adjuvants (GM-CSF, TLR/CD40 agonists?) with adjuvants (GM-CSF, TLR/CD40 agonists?) longer peptides (naturally flanking sequences) longer peptides (naturally flanking sequences) modified peptides (lipid tails?) modified peptides (lipid tails?) size of peptides: SLPs ? size of peptides: SLPs ? vaccination schedule: ? vaccination schedule: ? dose: ? dose: ? routes of injection: id, sc, it ? routes of injection: id, sc, it ? Peptide Vaccination

63 The Hallmarks of Peptide Vaccination (1) (2) (3) (4) (5) (6) (7) van Hall & van der Burg, 2012 SOS!!!

64 Ca αντιγόνο όχημα ανοσοενιχυτικό Τα στοιχεία των σύγχρονων πεπτιδικών αντικαρκινικών εμβολίων 

65 Τροποποιήσεις συνθετικών πεπτιδίων (κλινική δοκιμή με επίτοπο της gp100 σε ασθενείς με μελάνωμα) gp : gp : I T D Q V P F S Vwild type I T D Q V P F S Vwild type I M D Q V P F S V I M D Q V P F S V modified gp (M) vs. gp (wt) : in vitro studies: 9-fold better binding to HLA-A*201 9-fold better binding to HLA-A*201 higher levels of IFN-γ and GM-CSF production by gp (M) – specific T cell clones higher levels of IFN-γ and GM-CSF production by gp (M) – specific T cell clones Clinical studies (melanoma patients) VaccinationReactivity in vitro (%) to Clinical objective responses (%) gp100(wt)gp100(M) gp100 (wt) +IFA+IL gp100 (M) +IFA+IL

66 Ανάλογα πεπτιδίων (CEA) με αυξημένη συγγένεια για δέσμευση στον TCR CEA : CEA : Y L S G A N L N Lwild type Y L S G A N L N Lwild type Y L S G A D L N L peptide analog (610D) Biological properties Biological properties CEA CEA (610D) CEA CEA (610D) MHC class I binding ++++ Lysis of indicator cells μM μM TAP-70 phosphorylation +++ GM-CSF production (3ng/mL) 0,002μg/mL 0,2 μg/mL IFN-γ production (2ng/mL) 0,002 μg/mL 0,2μg/mL

67 GARDASIL: From Bench Top to Bed-side Vaccine charasteristics non-infectious recombinant (yeast) non-infectious recombinant (yeast) quadrivalent (capsid prt of HPV types 6, 11, 16, 18) quadrivalent (capsid prt of HPV types 6, 11, 16, 18) approved for women aged 9-26 years approved for women aged 9-26 years prevention of cervical cancer & genital wards, prevention of cervical cancer & genital wards, vulvar and vaginal precancerous lesions Vaccine charasteristics non-infectious recombinant (yeast) non-infectious recombinant (yeast) quadrivalent (capsid prt of HPV types 6, 11, 16, 18) quadrivalent (capsid prt of HPV types 6, 11, 16, 18) approved for women aged 9-26 years approved for women aged 9-26 years prevention of cervical cancer & genital wards, prevention of cervical cancer & genital wards, vulvar and vaginal precancerous lesions Clinical trials Phase I : 2,391 women, efficacy 100 % over 40 months Phase I : 2,391 women, efficacy 100 % over 40 months Phase II : 552 women, efficacy 100 % over 5 years Phase II : 552 women, efficacy 100 % over 5 years Phase III : 18,000 women, efficacy 100 % over 2 years Phase III : 18,000 women, efficacy 100 % over 2 years Clinical trials Phase I : 2,391 women, efficacy 100 % over 40 months Phase I : 2,391 women, efficacy 100 % over 40 months Phase II : 552 women, efficacy 100 % over 5 years Phase II : 552 women, efficacy 100 % over 5 years Phase III : 18,000 women, efficacy 100 % over 2 years Phase III : 18,000 women, efficacy 100 % over 2 years

68 Ca αντιγόνο όχημα ανοσοενιχυτικό Τα στοιχεία των σύγχρονων πεπτιδικών αντικαρκινικών εμβολίων 

69 To Optimize Vaccine Delivery…

70 Because Cancer Cells are “smart”…

71 BUT…mature DCs can be “smarter” ! Fujii et al., 2009

72 Επιλογή μονοκυττάρων GM-CSFIL-4 Ανώριμα DCs TNF-α “Φόρτωμα” με αντιγόνα Ώριμα DCs PBMC (λευκαφαίρεση) Επανέγχυση Παρασκευή δενδριτικών κυττάρων in vitro 5-6 ημέρες 1-2 ημέρες ώρες ώρες

73 General Protocol day –10:FLT3 day –10:FLT3 days 0 and 28:Leucapheresis days 0 and 28:Leucapheresis days 7 and 33:DC vaccination days 7 and 33:DC vaccination day 58 and on: Follow-up day 58 and on: Follow-up CTL-PRECTL-POST CEA + -CTL- PRE CEA + -CTL- POST CEA + -CTL FOLD EXPANSION CR (n=4)3-5 %26-38 %0,28-0,40 %1,03-1,15 %2,6-3,7 PD (n=7)3-12 %0-43 %0,03-0,26 %0,04-0,50 %0-1,1 SD (n=2)5-8 %33-41 %0,15-0,43 %1,05-1,11 %2,4-7,4 CEA-pulsed DCs used for vaccination of CEA + tumor patients

74 Σύντηξη δενδριτικών με καρκινικά κύτταρα (DC/Tu Hubrids) Avigan et al., 2012

75 Ca αντιγόνο όχημα ανοσοενιχυτικό Τα στοιχεία των σύγχρονων πεπτιδικών αντικαρκινικών εμβολίων  ?

76 Υποδοχείς Toll: από τη δροσόφιλα στον άνθρωπο Christiane Nüsslein-Volhard Νόμπελ Φυσιολογίας 1995 Anderson et al, 1985

77 Ο υποδοχέας τύπου Toll 4 αναγνωρίζει τον LPS των Gram - βακτηρίων  Ψευδομονάδα  Klebsiella  Salmonella  Escherichia coli  Neisseria

78 Μετά από 100 χρόνια, ο Coley είχε δίκιο ! Coley, 1893 William Coley Τοξίνη του Coley Βακτηριακό παρασκεύασμα/Εμβόλιο (Streptococcus + Staphylococcus) σαρκώματα 10% θεραπεία

79 Τι κάνουν τα ανοσοενισχυτικά ? Ο στόχος είναι να αυξήσουν την ανοσογονικότητα των αντιγόνων Ο στόχος είναι να αυξήσουν την ανοσογονικότητα των αντιγόνων Οι μηχανισμοί δράσης τους ελάχιστα κατανοητοί Οι μηχανισμοί δράσης τους ελάχιστα κατανοητοί Δεν υπάρχουν πρότυπες δοκιμασίες για να καθοριστεί η ανοσοενίσχυση (adjuvanticity). Συνήθως μετρούμε τις ανοσολογικές ή κλινικές απαντήσεις Δεν υπάρχουν πρότυπες δοκιμασίες για να καθοριστεί η ανοσοενίσχυση (adjuvanticity). Συνήθως μετρούμε τις ανοσολογικές ή κλινικές απαντήσεις Δρουν ανάλογα με τη φύση του αντιγόνου, χυμικές vs κυτταροτοξικές απαντήσεις Δρουν ανάλογα με τη φύση του αντιγόνου, χυμικές vs κυτταροτοξικές απαντήσεις Coukos et al., 2011

80  Εξειδικευμένοι ανοσοτροποποιητές Κυτταροκίνες (GM-CSF, IL-2, IFN-α, κ.α.) CD40-συνδέτης, αντι-CD40 Αb  Μη εξειδικευμένοι ανοσοτροποποιητές IFA, Montanide ISA 51 και 720 (γαλακτώματα νερού –λαδιού) Άλατα αλουμινίου (alum) Keyhole Limpet Hemocyanin (KLH)  Ανοσοενισχυτές Συνδέτες των υποδοχέων τύπου Toll (TLR), NOD, κ.α. λιποπολυσακχαρίτες (LPS, MPLA), λιποπεπτίδια (MALP-2) πεπτιδογλυκάνες dsRNA (Poly I:C), ολιγο-δεοξυνουκλεοτίδια (CpG), ανάλογα DNA, RNA (imiquimod) μυκοβακτηριδιακά στελέχη (BCG) Προθυμοσίνη α (προΤα) Ανοσοενισχυτικά/Ανοσοτροποποιητικά μόρια (Adjuvants)

81 Η απόδειξη στα ποντίκια…. Imiquimod = αγωνιστής του TLR-7 Sidbury et al, 2003 αιμαγγειο- ενδοθηλίωμα Μάρτυρας Ημέρα 9 Ημέρα 17

82 …αλλά και στον άνθρωπο Βασικοκυτταρικά Ca Tandon & Brodell, εβδομάδες μετά 12 εβδομάδες μετά

83 Κλινικές δοκιμές με αγωνιστές των TLR BCG (TLR-2, -4, -1/6): Ca ουροδόχου, μαστού, πνεύμονα, εντέρου, ωοθηκών BCG (TLR-2, -4, -1/6): Ca ουροδόχου, μαστού, πνεύμονα, εντέρου, ωοθηκών MPLA (TLR-4): NSC πνεύμονα, μεταστατικό μελάνωμα, μαστός, κεφαλής και τραχήλου MPLA (TLR-4): NSC πνεύμονα, μεταστατικό μελάνωμα, μαστός, κεφαλής και τραχήλου CpG ολιγονουκλεοτίδια (TLR-9): μελάνωμα, γλοιοβλάστωμα, σάρκωμα,μεταστατικό μαστού CpG ολιγονουκλεοτίδια (TLR-9): μελάνωμα, γλοιοβλάστωμα, σάρκωμα,μεταστατικό μαστού Poly-I:C (TLR-3): προστάτη, μελάνωμα, ωοθηκών Poly-I:C (TLR-3): προστάτη, μελάνωμα, ωοθηκών Imiquimod (TLR-7): μελάνωμα, προστάτη, ΧΛΛ, εγκεφάλου, νευροβλάστωμα Imiquimod (TLR-7): μελάνωμα, προστάτη, ΧΛΛ, εγκεφάλου, νευροβλάστωμα

84 Matzinger, 2000; Brennan et al, 2010 Οι TLRs ενεργοποιούνται και από DAMPs

85 2013: ο ανοσογονικός τύπου θανάτου Kono & Mimura, 2013 χημειοθεραπεία ή/και ακτινοθεραπεία Ca κύτταρα που πεθαίνουν Ενεργοποίηση και ωρίμανση δενδριτικών κυττάρων Παρουσίαση Ca αντιγόνων στα Τ κύτταρα ογκοειδικά Τ κύτταρα  καρκινικό Δενδριτικό κύτταρο HSP, προΤα, +++

86 Human Tumors are Immunogenic : because:  tumor cellsexpress defined antigens (>500 known)  tumor cells express defined antigens (>500 known)  solid tumors have infiltrating lymphocytes  tumor-specific T cells and Abs in the periphery of cancer patients  some tumors regress spontaneously :  BUT: most tumor antigens are “self” proteins most tumor antigens are “self” proteins tumors induce tolerance tumors induce tolerance tumors induce immune suppression (Tregs) tumors induce immune suppression (Tregs)

87 Τρόποι διαφυγής των καρκινικών κυττάρων από την ανοσοεπιτήρηση

88 Frequency of HLA class I antigen loss or down-regulation in various human cancers

89 Frequency of TAP loss or down-regulation in various human cancers

90 Abnormal expression of adhesion or accessory molecules Changes in T cell signal transduction molecules Anergy induction or clonal deletion of responding cells Utilization of products of tumor- stimulated leukocytes for tumor cell growth Inhibition of NK-activity by the absence of activating ligands and/or presence of inhibitory receptors Failure to express MHC antigen Induction of suppressor (regulatory) cells Occurence in immuno suppressed hosts Decrease of and heterogeneity of TAA expression Secretion of immune -downregulatory soluble factors Σύνοψη των μηχανισμών διαφυγής καρκινικών κυττάρων από την ανοσοεπιτήρηση


Κατέβασμα ppt "ΚΑΡΚΙΝΙΚΑ ΑΝΤΙΓΟΝΑ: ΧΑΡΑΚΤΗΡΙΣΜΟΣ ΚΑΙ ΤΑΥΤΟΠΟΙΗΣΗ ΤΟΥΣ Ράνια Τσιτσιλώνη."

Παρόμοιες παρουσιάσεις


Διαφημίσεις Google